Structure of PDB 7skz Chain H Binding Site BS01

Receptor Information
>7skz Chain H (length=226) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVLPGGSLRLSCSASGFTFSDFSMHWVRQSPGKGLEYVSA
ITSSGSSTYYPDSVKGRFTISRDNSKNTLYLQMGSLRVEDTAVYWCVKNS
DVFRFPHLYFDVWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC
LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG
TQTYICNVNHKPSNTKVDKRVEPKSC
Ligand information
>7skz Chain A (length=12) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SKRSFIEDLLFN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7skz ACE2-binding exposes the SARS-CoV-2 fusion peptide to broadly neutralizing coronavirus antibodies.
Resolution1.86 Å
Binding residue
(original residue number in PDB)		D31 S33 A50 I51 T52 S53 S54 S56 S57 Y59 D101 V102 F103 F105
Binding residue
(residue number reindexed from 1)		D31 S33 A50 I51 T52 S53 S54 S56 S57 Y59 D101 V102 F103 F105
External links