Structure of PDB 7sjp Chain H Binding Site BS01

Receptor Information
>7sjp Chain H (length=221) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVQSGAEVKKPGASVKVSCKASGYKFTDSEMHWVRQAPGQGLEWIGG
VDPETEGAAYNQKFKGRATITRDTSTSTAYLELSSLRSEDTAVYYCTRGY
DYDYALDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY
ICNVNHKPSNTKVDKKVEPKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7sjp Allosteric inhibition of HTRA1 activity by a conformational lock mechanism to treat age-related macular degeneration.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		D31 S32 E33 D52 E54 A59 G99 Y100 D101 Y102
Binding residue
(residue number reindexed from 1)		D31 S32 E33 D52 E54 A59 G99 Y100 D101 Y102
External links