Structure of PDB 7sg5 Chain H Binding Site BS01

Receptor Information

>7sg5 Chain H (length=221) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QRQLVQSGAEVKKPGASVKVSCKASGYTFTSYAIHWVRQAPGQRLEWMGW
IKAGNGNTRYSQKFQDRVTITRDTSTTTAYMELSSLRSEDTAVYYCALLT
VLTPDDAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
TYICNVNHKPSNTKVDKKVEP

Ligand information

>7sg5 Chain A (length=13) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

NPDPNANPNVDPN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7sg5 Highly protective antimalarial antibodies via precision library generation and yeast display screening.
Resolution	1.4 Å
Binding residue (original residue number in PDB)	Y32 A33 H35 W50 K52 R58 L95 T96 V97 L98 T99 P100
Binding residue (residue number reindexed from 1)	Y32 A33 H35 W50 K52 R59 L99 T100 V101 L102 T103 P104

External links

PDB	RCSB:7sg5, PDBe:7sg5, PDBj:7sg5
PDBsum	7sg5
PubMed	35736810

[Back to BioLiP]