Structure of PDB 7sbb Chain H Binding Site BS01

Receptor Information
>7sbb Chain H (length=223) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKIYRCKLTLHDNVFFASREMGILYETEKYFHNWALSYAFFKGTIIPHPY
GLVGQNAQTPAYLDRDREQNLLHLNDSGIYVFPAQPIHWSYQINTFKAAQ
SAYYGRNYGRAKELAVGSEFLTYIVSQKELDLPVWIRLGKWSSKIRVEVE
AIAPDQIKTASGVYVCNHPLNPLDCPANQQILLYNRVVMPPSSLFSQSQL
QGDYWQIDRNTFLPQGFHYGATT
Ligand information
>7sbb Chain Z (length=43) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acugaaacgauuguugugccccuggcggucgcuuucaaugccu
...........................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7sbb Structural rearrangements allow nucleic acid discrimination by type I-D Cascade.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		F17 A18 S19 H33 Y39 K43 L53 A58 Q59 T60 P61 A62 Y63 T96 F97 K98 A99 A100 R153 L154 K156 M205 P206
Binding residue
(residue number reindexed from 1)		F16 A17 S18 H32 Y38 K42 L52 A57 Q58 T59 P60 A61 Y62 T95 F96 K97 A98 A99 R137 L138 K140 M189 P190
Enzymatic activity
Enzyme Commision number ?
External links