Structure of PDB 7rnj Chain H Binding Site BS01

Receptor Information
>7rnj Chain H (length=198) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVQSGAEVKKPGASVKVSCKASGYTFTSQYMHWVRQAPGQGLEWIGI
INPSGVHTSYAQKFQGRVTLTRDTSTSTLYMELSSLRSEDTAVYYCARGS
PKGAFDYWGQGTLVTVSSASTGPSVFGTAALGCLVKDYFPEPVTVSWNSG
ALTSGVHTFPAVSSGLYSLSSVVTVPSSSLGTQTYICNVHKPSNTKVD
Ligand information
>7rnj Chain B (length=14) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DSFKEELDKYFKNH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rnj Broad betacoronavirus neutralization by a stem helix-specific human antibody.
Resolution2.67 Å
Binding residue
(original residue number in PDB)
Y33 H57 P101 K102 G103
Binding residue
(residue number reindexed from 1)
Y33 H57 P101 K102 G103
External links