Structure of PDB 7rda Chain H Binding Site BS01

Receptor Information
>7rda Chain H (length=220) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLVQSGAEVKKPGASVKVSCKASGYTFTTYAIHWVRQAPGQRLEWMGWI
KVGDGNTRYSPKFQGRVTITRDTSASTAYMELSSLRSEDTAVYFCALLTV
ITPDDAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKKVEP
Ligand information
>7rda Chain C (length=14) Species: 5833 (Plasmodium falciparum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NPDPNANPNVDPNA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rda Vaccination in a humanized mouse model elicits highly protective PfCSP-targeting anti-malarial antibodies.
Resolution1.92 Å
Binding residue
(original residue number in PDB)		Y32 A33 H35 W50 K52 R58 L95 T96 V97 I98
Binding residue
(residue number reindexed from 1)		Y31 A32 H34 W49 K51 R58 L98 T99 V100 I101
External links