Structure of PDB 7rcs Chain H Binding Site BS01

Receptor Information
>7rcs Chain H (length=220) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLVQSGAEVKKPGASVKVSCKASGYTFTSYAIHWVRQAPGQRLEWMGWI
KAGNGNTRYSQKFQGRVTITRDTSASTAYMELSSLRSEDTAGYYCALLTV
ITPDDAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKKVEP
Ligand information
>7rcs Chain C (length=15) Species: 5833 (Plasmodium falciparum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NPDPNANPNVDPNAN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rcs Vaccination in a humanized mouse model elicits highly protective PfCSP-targeting anti-malarial antibodies.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		A33 H35 W50 R58 L95 T96 V97 I98 T99 P100
Binding residue
(residue number reindexed from 1)		A32 H34 W49 R58 L98 T99 V100 I101 T102 P103
External links