Structure of PDB 7raq Chain H Binding Site BS01

Receptor Information
>7raq Chain H (length=227) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVQLVESGAEVKKPGESLKISCKGSGYTFTRYWIGWVRQMPGKGLEWMGI
IYPGDSDTRYSPSFQGHVTISADKSISTAYLQWNSLKASDTAMYYCARLP
QYCSNGVCQRWFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAAL
GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS
LGTQTYICNVNHKPSNTKVDKKVEPKS
Ligand information
>7raq Chain P (length=15) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LDKYFKNHTSPDVDL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7raq Structural definition of a pan-sarbecovirus neutralizing epitope on the spike S2 subunit.
Resolution1.74 Å
Binding residue
(original residue number in PDB)		T30 R31 Y32 W33 Y52 D54 D56 R94 Q97 Y98 C99 C100D
Binding residue
(residue number reindexed from 1)		T30 R31 Y32 W33 Y52 D55 D57 R98 Q101 Y102 C103 C108
External links