Structure of PDB 7qgg Chain H Binding Site BS01

Receptor Information
>7qgg Chain H (length=225) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NFAELKVKRLRKKFALKTLRKARRKLIYEKAKHYHKEYRQMYRTEIRMAR
MARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFV
KLNKASVNMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNS
LVARSLGKFGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKK
TTHFVEGGDAGNREDQINRLIRRMN
Ligand information
>7qgg Chain E (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucuacggccauaccacccugaacgcgcccgaucucgucugaucucggaa
gcuaagcagggucgggccugguuaguacuuggaugggagaccgccuggga
auaccgggugcuguaggcu
<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<<.....<<.<<..<<....>>.>>.>>..
..>>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qgg Neuronal RNA granules are ribosome complexes stalled at the pre-translocation state.
Resolution2.86 Å
Binding residue
(original residue number in PDB)		R146 E149 K234 T236 H238 V240 E241
Binding residue
(residue number reindexed from 1)		R111 E114 K199 T201 H203 V205 E206
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0042802 identical protein binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0042273 ribosomal large subunit biogenesis
GO:0097421 liver regeneration
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0014069 postsynaptic density
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0031672 A band
GO:0045202 synapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qgg, PDBe:7qgg, PDBj:7qgg
PDBsum7qgg
PubMed36038000
UniProtP05426|RL7_RAT Large ribosomal subunit protein uL30 (Gene Name=Rpl7)

[Back to BioLiP]