Structure of PDB 7ow1 Chain H Binding Site BS01

Receptor Information
>7ow1 Chain H (length=219) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTSYGIHWVRQSPGKGLEWLGV
MWSGGITDFYAAFISRLSISRDISKSQVFFKMNSLQADDTAIYYCARGSR
YALDYWGQGTSVSVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP
EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN
VNHKPSNTKVDKKVEPKSC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ow1 Discovery of a novel pseudo beta-hairpin structure of N-truncated amyloid-beta for use as a vaccine against Alzheimer's disease.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		G33 W52 S53 G98 S99 R100 Y101 A102
Binding residue
(residue number reindexed from 1)		G33 W52 S53 G98 S99 R100 Y101 A102
External links