Structure of PDB 7o31 Chain H Binding Site BS01

Receptor Information
>7o31 Chain H (length=221) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVQPGGSLKLSCAASGFTFSSYGMSWVRQTPDKRLELVAT
INSNGGSTYYLDSVKGRFTISRDKAKNTLYLQMSSLKSEDTAMYYCVRGG
SIYDGYDYAMDYWGQGTSVTVSSASTKGPSVFPLAPSGGTAALGCLVKDY
FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI
CNVNHKPSNTKVDKKVEPKSC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7o31 Molecular recognition of structurally disordered Pro/Ala-rich sequences (PAS) by antibodies involves an Ala residue at the hot spot of the epitope.
Resolution1.55 Å
Binding residue
(original residue number in PDB)		I102 Y103 D104 G105 Y106 D107 Y108 A109
Binding residue
(residue number reindexed from 1)		I102 Y103 D104 G105 Y106 D107 Y108 A109
External links