Structure of PDB 7nkp Chain H Binding Site BS01

Receptor Information
>7nkp Chain H (length=46) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLATFVFTRTTAGEIGILPRHIPLVAQLVDDAMVRVEFLSVTEETV
Ligand information
>7nkp Chain G (length=24) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ELAGASALDHTLYSFEPDPETLFD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nkp Structure of the ATP synthase from Mycobacterium smegmatis provides targets for treating tuberculosis.
Resolution4.06 Å
Binding residue
(original residue number in PDB)		T28 I32 P40 L41 V42 Q44
Binding residue
(residue number reindexed from 1)		T11 I15 P23 L24 V25 Q27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005524 ATP binding
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Biological Process
GO:0006754 ATP biosynthetic process
GO:0015986 proton motive force-driven ATP synthesis
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005886 plasma membrane
GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nkp, PDBe:7nkp, PDBj:7nkp
PDBsum7nkp
PubMed34782468
UniProtA0R1Z9|ATPE_MYCS2 ATP synthase epsilon chain (Gene Name=atpC)

[Back to BioLiP]