Structure of PDB 7n0x Chain H Binding Site BS01

Receptor Information
>7n0x Chain H (length=217) Species: 9544 (Macaca mulatta) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVQPGGSLRLSCAASGFTFSNCAMHWVRQAPGKGLEWVAV
ISYHGSNKYYADYVKGRFTISRDNSKNMLYLQMNNLKLEDTAVYYCAREG
GAPSGWALDYWGQGVLVTVSSASTKGPSVFPLAPSSESTAALGCLVKDYF
PEPVTVSWNSGSLTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYVC
NVNHKPSNTKVDKRVEI
Ligand information
>7n0x Chain G (length=18) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DKKQKVHALFYKLDIVPI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7n0x Structure and Fc-Effector Function of Rhesusized Variants of Human Anti-HIV-1 IgG1s.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		S52 Y52A N56 Y58 A98 P99 S100 G100A W100B
Binding residue
(residue number reindexed from 1)		S52 Y53 N57 Y59 A102 P103 S104 G105 W106
External links