Structure of PDB 7n08 Chain H Binding Site BS01

Receptor Information
>7n08 Chain H (length=233) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLVESGGGLVQPGRSLRLSCAASGFTFNDYAMHWVRQAPGKGLEWVSGI
SWDSSSIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDMALYYCVKGRD
YYDSGGYFTVAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAAL
GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS
LGTQTYICNVNHKPSNTKVDKKVEPKSCGRLVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7n08 Conformational plasticity of the HIV-1 gp41 immunodominant region is recognized by multiple non-neutralizing antibodies.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		W47 G50 W52A D53 S55 S56 G58 Y100D F100E
Binding residue
(residue number reindexed from 1)		W46 G49 W52 D53 S55 S56 G58 Y107 F108
External links