Structure of PDB 7n05 Chain H Binding Site BS01

Receptor Information
>7n05 Chain H (length=221) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGGGVVKPGASLRLACSASGFTFTDYYMSWIRQTPGKGLQWLAY
ITKDGSEKKYADSLQGRFAVSRDNANNLVFLQLNTVEDDDTGVYYCARDD
GYYDRSGYYGVFDLWGQGIRVTVSSASTKGPSVFPLAPSSGTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKKVEPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7n05 Conformational plasticity of the HIV-1 gp41 immunodominant region is recognized by multiple non-neutralizing antibodies.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		D31 Y32 Y33 K52A D95 D96 G97 Y98 Y99 Y100D
Binding residue
(residue number reindexed from 1)		D31 Y32 Y33 K53 D99 D100 G101 Y102 Y103 Y108
External links