Structure of PDB 7m53 Chain H Binding Site BS01

Receptor Information
>7m53 Chain H (length=220) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLQQSGPVLVKPGASVRMSCKASGYTITDYYLNWVKQSHGKSLEWLGV
LNPYSGGSLYSQTFKGKATLTVDRSSSTAYLELNSLTSEDSAVYYCARQL
GRGNGLDYWGQGTSVTVSSVSTKGPSVFPLAPSSKSTSGGTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY
ICNVNHKPSNTKVDKRVEPK
Ligand information
>7m53 Chain A (length=10) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SFKEELDKYF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7m53 Structural basis for broad coronavirus neutralization.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		Y35 W49 V52 L53 N54 G59 S60 L61 Y62 G103 R104
Binding residue
(residue number reindexed from 1)		Y33 W47 V50 L51 N52 G57 S58 L59 Y60 G101 R102
External links