Structure of PDB 7lo0 Chain H Binding Site BS01

Receptor Information
>7lo0 Chain H (length=152) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESE
EYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTY
RGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHI
NW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lo0 Tousled-like kinase 2 targets ASF1 histone chaperones through client mimicry.
Resolution2.71 Å
Binding residue
(original residue number in PDB)		V45 A48 E49 E51 D54 D88 V92 V94 R108 G110 Y112 R145 T147 F149
Binding residue
(residue number reindexed from 1)		V44 A47 E48 E50 D53 D87 V91 V93 R107 G109 Y111 R144 T146 F148
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7lo0, PDBe:7lo0, PDBj:7lo0
PDBsum7lo0
PubMed35136069
UniProtQ9Y294|ASF1A_HUMAN Histone chaperone ASF1A (Gene Name=ASF1A)

[Back to BioLiP]