Structure of PDB 7lky Chain H Binding Site BS01

Receptor Information
>7lky Chain H (length=56) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDI
SPAALP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lky Discovery of an H3K36me3-Derived Peptidomimetic Ligand with Enhanced Affinity for Plant Homeodomain Finger Protein 1 (PHF1).
Resolution1.85 Å
Binding residue
(original residue number in PDB)
W32 G34
Binding residue
(residue number reindexed from 1)
W4 G6
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7lky, PDBe:7lky, PDBj:7lky
PDBsum7lky
PubMed33999620
UniProtO43189|PHF1_HUMAN PHD finger protein 1 (Gene Name=PHF1)

[Back to BioLiP]