Structure of PDB 7lfd Chain H Binding Site BS01

Receptor Information
>7lfd Chain H (length=224) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIQLVQSGPDLKKPGETVKISCRTSGYAFTNYGVNWVKQAPGKGLKWMGW
INTNTGQTTYAEEFRGRFAISLETSASTAFLTISNLKNEDSATYFCARLI
YDGDYISSDFWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
TYICNVNHKPSNTKVDKKVEPKSC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lfd Structures of the ApoL1 and ApoL2 N-terminal domains reveal a non-classical four-helix bundle motif.
Resolution2.157 Å
Binding residue
(original residue number in PDB)		T30 Y32 G33 W50 N52 T53 N54 Y101 G103 D104 Y105
Binding residue
(residue number reindexed from 1)		T30 Y32 G33 W50 N52 T53 N54 Y101 G103 D104 Y105
External links