Structure of PDB 7k7g Chain H Binding Site BS01

Receptor Information
>7k7g Chain H (length=92) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAA
YNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSS
Ligand information
>7k7g Chain J (length=123) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ttcttactatttcttttttaactttcggaaatcaaatacactaatattaa
aacgcgggggacagcgcgtacgtgcgtttaagcggtgctagagctgtcta
cgaccaattgagcggcctcggca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7k7g Structural and dynamic mechanisms of CBF3-guided centromeric nucleosome formation.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		S91 T92
Binding residue
(residue number reindexed from 1)		S55 T56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006301 postreplication repair
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0031298 replication fork protection complex
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7k7g, PDBe:7k7g, PDBj:7k7g
PDBsum7k7g
PubMed33741944
UniProtP02293|H2B1_YEAST Histone H2B.1 (Gene Name=HTB1)

[Back to BioLiP]