Structure of PDB 7k36 Chain H Binding Site BS01

Receptor Information

>7k36 Chain H (length=177) Species: 9606 (Homo sapiens)

RNRPGTKAQDFYNWTLAVQQYIQQNIRADCSNIDKILEPPDEGVWKYEHL
RQFCLELNGLAVKLQSECHPDTCIFLCAAHKTPKECPAIDYTRHTLDGAA
CLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYEN
ETFLCHRFTKFVMKYNLMSKDNLIVPI

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 7k36 Chain H Residue 301

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7k36 Cryo-EM structure of the Hippo signaling integrator human STRIPAK.
• Resolution: 3.3 Å
• Binding residue (original residue number in PDB): C110 H113 C119 H127
• Binding residue (residue number reindexed from 1): C77 H80 C86 H94
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0019900 kinase binding
• GO:0030674 protein-macromolecule adaptor activity
• GO:0046872 metal ion binding

Biological Process

• GO:0035331 negative regulation of hippo signaling

Cellular Component

• GO:0005737 cytoplasm
• GO:0005794 Golgi apparatus
• GO:0016020 membrane
• GO:0032580 Golgi cisterna membrane
• GO:0043025 neuronal cell body
• GO:0043197 dendritic spine
• GO:0048471 perinuclear region of cytoplasm
• GO:0090443 FAR/SIN/STRIPAK complex
• GO:0098794 postsynapse
• GO:0098978 glutamatergic synapse

External links

• PDB: RCSB:7k36, PDBe:7k36, PDBj:7k36
• PDBsum: 7k36
• PubMed: 33633399
• UniProt: Q9Y3A3|PHOCN_HUMAN MOB-like protein phocein (Gene Name=MOB4)