Structure of PDB 7eyc Chain H Binding Site BS01

Receptor Information
>7eyc Chain H (length=213) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQESGPGLVKPSQTLSLTCTVSGDSITSGYWNWIRQPPGKGLEYIGY
IRYSGRTYYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCASVYF
TYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV
TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTETYICNVNH
KPSNTKVDKKVEA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7eyc Monoclonal antibody Y01 prevents tauopathy progression induced by lysine 280-acetylated tau in cell and mouse models.
Resolution2.49 Å
Binding residue
(original residue number in PDB)		Y33 N35 Y50 R52 V95 Y96
Binding residue
(residue number reindexed from 1)		Y33 N35 Y50 R52 V98 Y99
External links