Structure of PDB 7ekk Chain H Binding Site BS01

Receptor Information
>7ekk Chain H (length=218) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLVQSGAEVKRPGSSVTVSCKASGGSFSTYALSWVRQAPGRGLEWMGGV
IPLLTITNYAPRFQGRITITADRSTSTAYLELNSLRPEDTAVYYCAREGT
TGCGGKPIGAFAHWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDY
FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI
CNVNHKPSNTKVDKKVEP
Ligand information
>7ekk Chain P (length=14) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NWFDITNWLWYIKK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ekk Focal accumulation of aromaticity at the CDRH3 loop mitigates 4E10 polyreactivity without altering its HIV neutralization profile.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		T31 W47 G50 V51 I52 I56 N58 E95 G100D K100E P100F
Binding residue
(residue number reindexed from 1)		T30 W46 G49 V50 I51 I56 N58 E98 G105 K106 P107
External links