Structure of PDB 7e6p Chain H Binding Site BS01

Receptor Information
>7e6p Chain H (length=217) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQQPGAELVRPGSSVKLSCRASGYTFTSYWVSWVQQRPGQGLEWIGM
IHPSDGEARLNQKFKDKATLTVDKSSTTVYMQLSSPTSEDSAVYYCALFD
GYYPWFASWGQGTLVTVSAAKTTPPSVYPLAPGQTNSMVTLGCLVKGYFP
EPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNV
AHPASSTKVDKKIVPRD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7e6p Characterization of a Conformation-Restricted Amyloid beta Peptide and Immunoreactivity of Its Antibody in Human AD brain.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		S31 W33 H52 D55 E57 R59 Y102 Y103 P104
Binding residue
(residue number reindexed from 1)		S31 W33 H52 D55 E57 R59 Y102 Y103 P104
External links