Structure of PDB 7bxv Chain H Binding Site BS01

Receptor Information
>7bxv Chain H (length=217) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LIQLVQSGPEVKKPGETVKISCTASGYTFTNYVIHWVKQAPGKGLKWMGW
IYTDTGEPTYADDFKGRFAFSLETSANTAYLQINNLKNEDMTTYFCAREA
YPNYFDYWGHGTTLTVSSAKTTPPSVYPLAPGSAAQNSMVTLGCLVKGYF
PEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCN
VAHPASSTKVDKKIVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bxv APOE epsilon 4 allele advances the age-dependent decline of amyloid beta clearance in the human cortex.
Resolution1.75 Å
Binding residue
(original residue number in PDB)		Y32 V33 W50 Y52 E99 A100 Y101 P102 N103
Binding residue
(residue number reindexed from 1)		Y32 V33 W50 Y52 E99 A100 Y101 P102 N103
External links