Structure of PDB 7bp4 Chain H Binding Site BS01

Receptor Information
>7bp4 Chain H (length=88) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSKLARYNK
KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bp4 NAP1-Related Protein 1 (NRP1) has multiple interaction modes for chaperoning histones H2A-H2B.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		K62 I63 F66 I78 S79 S80 K81 M83
Binding residue
(residue number reindexed from 1)		K3 I4 F7 I19 S20 S21 K22 M24
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7bp4, PDBe:7bp4, PDBj:7bp4
PDBsum7bp4
PubMed33199628
UniProtQ9LQQ4|H2B1_ARATH Histone H2B.1 (Gene Name=At1g07790)

[Back to BioLiP]