Structure of PDB 7apd Chain H Binding Site BS01

Receptor Information

>7apd Chain H (length=148) Species: 10571 (Bovine papillomavirus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GSRATVFKLGLFKSLFLCSFHDITRLFKNDKTTNQQWVLAVFGLAEVFFE
ASFELLKKQCSFLQMQKRSHEGGTCAVYLICFNTAKSRETVRNLMANMLN
VREECLMLQPPKIRGLSAALFWFKSSLSPATLKHGALPEWIRAQTTLN

Ligand information

>7apd Chain T (length=36) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cccccccgtgcgcgctgaggtgcggtgtgaaataca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7apd Unwinding of a DNA replication fork by a hexameric viral helicase.
Resolution	3.9 Å
Binding residue (original residue number in PDB)	R158 A159 K168 L172 H176 K279
Binding residue (residue number reindexed from 1)	R3 A4 K13 L17 H21 K124

Enzymatic activity

Enzyme Commision number

3.6.4.12: DNA helicase.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:7apd, PDBe:7apd, PDBj:7apd
PDBsum	7apd
PubMed	34545080
UniProt	P03116\|VE1_BPV1 Replication protein E1 (Gene Name=E1)

[Back to BioLiP]