Structure of PDB 6xlz Chain H Binding Site BS01

Receptor Information
>6xlz Chain H (length=214) Species: 9544 (Macaca mulatta) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLQLQESGPGLVKPSETLSLTCTVSDGSIRDYWWNWIRQPPGKGLEWIGR
IDSVVNTYYNPSLKSRVTLSVDTSKNQVSLRLSSVTAADTAVYYCARPYC
PGSACYDSWGQGVLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPV
TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH
KPSNTKVDKRVEPK
Ligand information
>6xlz Chain P (length=20) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LDIVPLEEERKGNSSKYRLI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xlz Structurally related but genetically unrelated antibody lineages converge on an immunodominant HIV-1 Env neutralizing determinant following trimer immunization.
Resolution2.8 Å
Binding residue
(original residue number in PDB)
D31 Y32 W33 R50 D52 S53
Binding residue
(residue number reindexed from 1)
D31 Y32 W33 R50 D52 S53
External links