Structure of PDB 6x8u Chain H Binding Site BS01

Receptor Information
>6x8u Chain H (length=214) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AYLQQSGAELVRSGASVKMSCKASGYTFTSYNMHWVKQTPGQGLEWIGYI
YPGNGVTNFNQKFKGKATLTADTSSSTAYMQISSLTSEDSAVYFCASAAY
WGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTV
SWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKP
SNTKVDKKVEPKSC
Ligand information
>6x8u Chain P (length=12) Species: 5823 (Plasmodium berghei ANKA) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PPPNPNDPAPPN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6x8u Structural ordering of the Plasmodium berghei circumsporozoite protein repeats by inhibitory antibody 3D11.
Resolution1.55 Å
Binding residue
(original residue number in PDB)		Y32 N33 H35 Y50 Y52 N54 V56 A95
Binding residue
(residue number reindexed from 1)		Y31 N32 H34 Y49 Y51 N54 V56 A98
External links