Structure of PDB 6x8s Chain H Binding Site BS01

Receptor Information
>6x8s Chain H (length=213) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YLQQSGAELVRSGASVKMSCKASGYTFTSYNMHWVKQTPGQGLEWIGYIY
PGNGVTNFNQKFKGKATLTADTSSSTAYMQISSLTSEDSAVYFCASAAYW
GQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPS
NTKVDKKVEPKSC
Ligand information
>6x8s Chain P (length=13) Species: 5823 (Plasmodium berghei ANKA) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PPPPNANDPPPPN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6x8s Structural ordering of the Plasmodium berghei circumsporozoite protein repeats by inhibitory antibody 3D11.
Resolution1.55 Å
Binding residue
(original residue number in PDB)		Y32 N33 H35 Y50 Y52 N54 V56 A95
Binding residue
(residue number reindexed from 1)		Y30 N31 H33 Y48 Y50 N53 V55 A97
External links