Structure of PDB 6x7w Chain H Binding Site BS01

Receptor Information
>6x7w Chain H (length=221) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVMLVESGGGLVKPGGSLKLSCEASGFSFGFYSLSWVRQTPEKRLEWVAT
IAGSGVGGQTYYPDSVKGRFTISRDNAKNTLYLQMSSLRSEDTAVFYCAR
HGEGKYGSNFAYWGQGTTLTVSSASTTPPSVYPLAPGSANSMVTLGCLVK
GYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETV
TCNVAHPASSTKVDKKIVPRD
Ligand information
>6x7w Chain G (length=8) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVGLGAVF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6x7w Distinct Classes of HIV-1 Cross-Clade Neutralizing Antibodies Targeting Fusion Peptide Elicited in Mice by Diverse Immunization Regimens
Resolution1.7 Å
Binding residue
(original residue number in PDB)		F31 Y32 S33 G52C V53 G96 E97 G98 G100A S100B
Binding residue
(residue number reindexed from 1)		F31 Y32 S33 G55 V56 G102 E103 G104 G107 S108
External links