Structure of PDB 6x78 Chain H Binding Site BS01

Receptor Information
>6x78 Chain H (length=223) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQQPGAEFVKPGASVRMSCKASGYTFTSYWIAWVKQRPGQGLEWIGD
IYPGSGYTNYNGKLKNRATLTVDTSSNTAYMQLSSLTSEDSAVYYCTRGG
TTFVAEPWLAYWGQGTLVAVSAASTTPPSVYPLAPGSAAQTNSMVTLGCL
VKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSE
TVTCNVAHPASSTKVDKKIVPRD
Ligand information
>6x78 Chain G (length=5) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVGLG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6x78 Distinct Classes of HIV-1 Cross-Clade Neutralizing Antibodies Targeting Fusion Peptide Elicited in Mice by Diverse Immunization Regimens
Resolution2.359 Å
Binding residue
(original residue number in PDB)		W33 T97 T98 F99 V100 W100D
Binding residue
(residue number reindexed from 1)		W33 T101 T102 F103 V104 W108
External links