Structure of PDB 6x5n Chain H Binding Site BS01

Receptor Information
>6x5n Chain H (length=225) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVQPGGSLRLSCAASGFYISYSSIHWVRQAPGKGLEWVAS
ISPYSGSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARQG
YRRRSGRGFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL
VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPKSC
Ligand information
>6x5n Chain R (length=39) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggguuuuuccuucgaaacacgaagguuuuuaucccugcc
<<<.....<<<<<<.....>>>>>>.......>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6x5n Dynamic bulge nucleotides in the KSHV PAN ENE triple helix provide a unique binding platform for small molecule ligands.
Resolution3.3 Å
Binding residue
(original residue number in PDB)
Y34 Y57 S58 S60 Q102 Y104 R105 R106 R110
Binding residue
(residue number reindexed from 1)
Y31 Y54 S55 S57 Q99 Y101 R102 R103 R107
External links