Structure of PDB 6x1w Chain H Binding Site BS01

Receptor Information
>6x1w Chain H (length=215) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSVEESEGGLIKPGGILTLTCTASGFSLSSYGFSWVRQAPGKGLEHIGYL
HANGRAYYATWAKSRSTITRNTNLNTVTLQLTSLTAADTATYFCAKIGSV
SDVAIWGPGTLVTISGQPKAPSVFPLAPCCGDTPSSTVTMGCLVKGYLPE
PVTVTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQPVTCNVAHP
ATNTKVDKTVAPSTC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6x1w Structural basis for differential recognition of phosphohistidine-containing peptides by 1-pHis and 3-pHis monoclonal antibodies.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		Y50 H52 K94 G96 S97 V98 S99
Binding residue
(residue number reindexed from 1)		Y49 H51 K96 G98 S99 V100 S101
External links