Structure of PDB 6wz5 Chain H Binding Site BS01

Receptor Information
>6wz5 Chain H (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEA
SRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Ligand information
>6wz5 Chain I (length=153) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tgcacaggatgtatatatctgacacgtgcctggagactagggagtaatcc
ccttggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtg
ctagagctgtctacgaccaattgagcggcctcggcaccgggattctccag
ggc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wz5 Bridging of DNA breaks activates PARP2-HPF1 to modify chromatin.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
R27 K28 R30 K31 S33 I36 Y37
Binding residue
(residue number reindexed from 1)
R3 K4 R6 K7 S9 I12 Y13
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:6wz5, PDBe:6wz5, PDBj:6wz5
PDBsum6wz5
PubMed32939087
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]