Structure of PDB 6wx2 Chain H Binding Site BS01

Receptor Information
>6wx2 Chain H (length=210) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLLQSGAELVRPGASVTLSCKASGYAFSDYEIHWVKQTPVRGLDWIGA
FDPKSGASASNQKVKGRAILTADKSSSTAYMELRSLTSEDSAVYYCTRLR
YFGYFDVWGTGTTVTVSSASTTPPSVYPLAPSMVTLGCLVKGYFPEPVTV
TWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPAS
STKVDKKIVP
Ligand information
>6wx2 Chain F (length=8) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVGIGAVF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wx2 Mutational fitness landscapes reveal genetic and structural improvement pathways for a vaccine-elicited HIV-1 broadly neutralizing antibody.
Resolution2.39 Å
Binding residue
(original residue number in PDB)		E33 A57 S58 L99 Y101 F102 G103
Binding residue
(residue number reindexed from 1)		E33 A57 S58 L99 Y101 F102 G103
External links