Structure of PDB 6wrs Chain H Binding Site BS01

Receptor Information
>6wrs Chain H (length=93) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASLKSIIRQGKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDEVEFIKV
IREVGRNGVIELGVGSKTIKVMVADYQFDPLKNQITHIDFLAI
Ligand information
>6wrs Chain 2 (length=111) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cuggugacuauagcaaggaggucacaccuguucccaugccgaacacagaa
guuaagcuccuuagcgacgaugguaguccaacuuacguuccgcuagagua
gaacguuccag
<<<<........<<<<<<<<.....<<<<<...............>>>..
>>....>>>>>>.>>.....<...<<..............>..>..>...
......>>.>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wrs Characterization of the Core Ribosomal Binding Region for the Oxazolidone Family of Antibiotics Using Cryo-EM.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		R9 T14 R15 S16 L18 K19 Y32 N38 Q78 H88
Binding residue
(residue number reindexed from 1)		R8 T13 R14 S15 L17 K18 Y31 N37 Q77 H87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6wrs, PDBe:6wrs, PDBj:6wrs
PDBsum6wrs
PubMed32566908
UniProtQ2G0S0

[Back to BioLiP]