Structure of PDB 6wn4 Chain H Binding Site BS01

Receptor Information
>6wn4 Chain H (length=221) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVQLQQSGAELVKPGASVKLSCKASGYTFTEYIIHWVKQKSGQGLEWIGW
FYPGSGNIKYNEKFKDKATLTADKSSSTVYMELSRLTSEDSAVYFCARHE
DRNYYSYWDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLV
KGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSET
VTCNVAHPASSTKVDKKIVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wn4 The structural basis for monoclonal antibody 5D2 binding to the tryptophan-rich loop of lipoprotein lipase.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		W69 Y71 K78 H118 D120 R121 N122 Y123
Binding residue
(residue number reindexed from 1)		W50 Y52 K59 H99 D101 R102 N103 Y104
External links