Structure of PDB 6wfx Chain H Binding Site BS01

Receptor Information
>6wfx Chain H (length=224) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQLVESGGGVVQPGRSLRLSCAAASEFCFSCYGMHWVRQAPGKGLEWVAV
IWHDGSNQHFADSVKGRFTISRDNSKNIMYLQMNSLRAEDTAVYYCASAT
RYDILTGAFDYWGQGTLVTVVSRRLPPSVFPLAPSSKSTSGGTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
TYICNVNHKPSNTKVDKKVEPKSC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wfx Structural and biophysical correlation of anti-NANP antibodies with in vivo protection against P. falciparum.
Resolution2.59 Å
Binding residue
(original residue number in PDB)		C32 Y33 G34 W52 H52A A95 Y98 I100 L100A T100B
Binding residue
(residue number reindexed from 1)		C31 Y32 G33 W52 H53 A99 Y102 I104 L105 T106
External links