Structure of PDB 6wfw Chain H Binding Site BS01

Receptor Information
>6wfw Chain H (length=212) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVESGGGVVQPGSLRLSCAASGFTFSGYGMHWVRQVPGKGLEWVAII
WFDGSQKYYADSVQGRFTISRDNKKTLFLRMNSLRAEDTAVYYCAKVHDD
EPTQDYWGQGTLVTVFNQIKGPSVFPLAPSSGTAALGCLVKDYFPEPVTV
SWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKP
SNTKVDKKVEPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wfw Structural and biophysical correlation of anti-NANP antibodies with in vivo protection against P. falciparum.
Resolution2.093 Å
Binding residue
(original residue number in PDB)		G31 Y32 G33 W52 F52A Y58 V95 H96
Binding residue
(residue number reindexed from 1)		G30 Y31 G32 W51 F52 Y58 V97 H98
External links