Structure of PDB 6w00 Chain H Binding Site BS01

Receptor Information

>6w00 Chain H (length=224) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QVQLVESGGGVVQPGRSLRLSCAASRLTFRNFGMHWVRQTPGKGLEWVAV
IWHDGSNKFYADSVEGRFTISRDNSKNTLYLQMNSLRDEDTAIYYCAKDW
GGASDRVFDYWGRGTLVIVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
TYICNVNHKPSNTKVDKKVEPKSC

Ligand information

>6w00 Chain P (length=8) Species: 5833 (Plasmodium falciparum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

NPNANPNA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6w00 Structural and biophysical correlation of anti-NANP antibodies with in vivo protection against P. falciparum.
Resolution	1.853 Å
Binding residue (original residue number in PDB)	N31 F32 G33 W52 H52A F58 D95 G97 A99 R100B
Binding residue (residue number reindexed from 1)	N31 F32 G33 W52 H53 F59 D99 G101 A103 R106

External links

PDB	RCSB:6w00, PDBe:6w00, PDBj:6w00
PDBsum	6w00
PubMed	33594061

[Back to BioLiP]