Structure of PDB 6vry Chain H Binding Site BS01

Receptor Information
>6vry Chain H (length=225) Species: 9544 (Macaca mulatta) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQESGPGLVKPSETLSLTCAVSGGSISDYYYWNWIRQFPGKGLEWIG
NIYGKSASTYYNPSLKSRVSISKDTSKNQFFLKLSSVTAADTAVYYCARE
YCIGSTCYPILDSWGQGAVVTVSSASTKGPSVFPLAPSSKSTSGGTAALG
CLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTQTYICNVNHKPSNTKVDKRVEPK
Ligand information
>6vry Chain G (length=11) Species: 11723 (Simian immunodeficiency virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GLKRDKTKEYN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vry HIV vaccine candidate with V1 deletion reveals virus vulnerability to V2 antibodies
Resolution1.4 Å
Binding residue
(original residue number in PDB)		Y32 Y33 Y34 Y52 S54 S56 Y58 E95 S100 T100A C100B Y100C P100D
Binding residue
(residue number reindexed from 1)		Y32 Y33 Y34 Y53 S56 S58 Y60 E100 S105 T106 C107 Y108 P109
External links