Structure of PDB 6vpx Chain H Binding Site BS01

Receptor Information
>6vpx Chain H (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVKPGGSLRLSCSASGFDFDNAWMTWVRQPPGKGLEWVGR
ITGPGEGWSVDYAAPVEGRFTISRLNSINFLYLEMNNLRMEDSGLYFCAR
TGKYYDFWSGYPPGEEYFQDWGRGTLVTV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vpx HIV-1 Envelope and MPER Antibody Structures in Lipid Assemblies.
Resolution5.0 Å
Binding residue
(original residue number in PDB)		W33 G52C E53 K97 Y99 F100A W100B G100D Y100E P100F P100G
Binding residue
(residue number reindexed from 1)		W33 G55 E56 K103 Y105 F107 W108 G110 Y111 P112 P113
External links