Structure of PDB 6vme Chain H Binding Site BS01

Receptor Information
>6vme Chain H (length=76) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLK
HVRLLSRKQFQLRALMQKARKTAGLS
Ligand information
>6vme Chain R (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SNASSLYGISAMDGVPFTLHP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vme A helical assembly of human ESCRT-I scaffolds reverse-topology membrane scission.
Resolution2.19 Å
Binding residue
(original residue number in PDB)
V317 I318 I319 P320 T321 Y325 Y332 E335 N336 E339 R381 S387
Binding residue
(residue number reindexed from 1)
V6 I7 I8 P9 T10 Y14 Y21 E24 N25 E28 R70 S76
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6vme, PDBe:6vme, PDBj:6vme
PDBsum6vme
PubMed32424346
UniProtQ99816|TS101_HUMAN Tumor susceptibility gene 101 protein (Gene Name=TSG101)

[Back to BioLiP]