Structure of PDB 6vjt Chain H Binding Site BS01

Receptor Information
>6vjt Chain H (length=223) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVESGGGVAQPGRSLRLSCAASGFSFSRHGMHWVRQAPGKGLEWVAG
IWFDGTNDYYTDSVKGRFTISRDNSRSTLYLDINSLRAEDTAVYYCARED
PHLLIATLDLWGLGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
TYICNVNHKPSNTKVDKRVEPKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vjt A Combination of Human Broadly Neutralizing Antibodies against Hepatitis B Virus HBsAg with Distinct Epitopes Suppresses Escape Mutations.
Resolution1.782 Å
Binding residue
(original residue number in PDB)		W52 F53 Y59 E99 P101 L103
Binding residue
(residue number reindexed from 1)		W52 F53 Y59 E99 P101 L103
External links