Structure of PDB 6vbw Chain H Binding Site BS01

Receptor Information
>6vbw Chain H (length=135) Species: 666 (Vibrio cholerae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTITFLPCNNESLAAKCLRVLHGFNYQYETRNIGVSFPLWCDATVGKKIS
FVSLLKQHYFVQMEQLQYFHIYVSFRRCQSIDKLTAAGLARKIRRLEKFD
PSSFAQKEHTAIAHYHSLGESSKQTNRNFRLNIRM
Ligand information
>6vbw Chain K (length=61) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cugauaacuuacaggacgcuuuggcuucauugcuuuucaggugaacugcc
gaguagguaga
.............................................<<<<<
.....>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vbw Structure-function insights into the initial step of DNA integration by a CRISPR-Cas-Transposon complex.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		H29 Y33 Q105 K109 A113 R117 K118 R121 F138 Y149 K157 Q158 R161 N162 F163 R164
Binding residue
(residue number reindexed from 1)		H22 Y26 Q79 K83 A87 R91 K92 R95 F104 Y115 K123 Q124 R127 N128 F129 R130
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 19:48:38 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6vbw', asym_id = 'H', bs = 'BS01', title = 'Structure-function insights into the initial ste...A integration by a CRISPR-Cas-Transposon complex.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6vbw', asym_id='H', bs='BS01', title='Structure-function insights into the initial ste...A integration by a CRISPR-Cas-Transposon complex.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0004519,0043571', uniprot = '', pdbid = '6vbw', asym_id = 'H'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519,0043571', uniprot='', pdbid='6vbw', asym_id='H')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>