Structure of PDB 6vbo Chain H Binding Site BS01

Receptor Information
>6vbo Chain H (length=210) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVQSGAEVKKPGESLKISCKGSGYKFSDYWIGWVRQMPGKGLESMGI
IYPGDSDTRYSPSFQGQVTISADKSINTAYLQWNTLKASDTAMYYCAIVG
AKADYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPS
NTKVDKRVEP
Ligand information
>6vbo Chain C (length=16) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KKQKVHALFYKLDIVP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vbo HIV vaccine delayed boosting increases Env variable region 2-specific antibody effector functions.
Resolution1.683 Å
Binding residue
(original residue number in PDB)		V2 Y32 W33 Y52 D54 D56 G96 A97 K98
Binding residue
(residue number reindexed from 1)		V2 Y32 W33 Y52 D55 D57 G100 A101 K102
External links