Structure of PDB 6v4x Chain H Binding Site BS01

Receptor Information
>6v4x Chain H (length=499) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDQLLIRPLGAGQEVGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDL
IDPAEIDLLLISHFHLDHCGALPWFLQKTSFKGRTFMTHATKAIYRWLLS
DYVKVSNISADDMLYTETDLEESMDKIETINFHEVKEVAGIKFWCYHAGH
VLGAAMFMIEIAGVKLLYTGDFSRQEDRHLMAAEIPNIKPDILIIESTYG
THIHEKREEREARFCNTVHDIVNRGGRGLIPVFALGRAQELLLILDEYWQ
NHPELHDIPIYYASSLAKKCMAVYQTYVNAMNDKIRKQININNPFVFKHI
SNLKSMDHFDDIGPSVVMASPGMMQSGLSRELFESWCTDKRNGVIIAGYC
VEGTLAKHIMSEPEEITTMSGQKLPLKMSVDYISFSAHTDYQQTSEFIRA
LKPPHVILVHGEQNEMARLKAALIREYEDNDEVHIEVHNPRNTEAVTLNF
RGEKLAKVMGFLADGQRVSGILVKRNFNYHILSPCDLSNYTDLAMSTVK
Ligand information
>6v4x Chain Y (length=25) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cacugaaucagauaaagagcuguaa
.........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6v4x Structure of an active human histone pre-mRNA 3'-end processing machinery.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		V23 P45 H73 L74 D75 D109 Y110 K112 V113 N115 H158 T206 Y207 S272 S273 K312 H316 S328 P329 S334 E339 Y357 H396 H418 E420
Binding residue
(residue number reindexed from 1)		V15 P37 H65 L66 D67 D101 Y102 K104 V105 N107 H150 T198 Y199 S264 S265 K304 H308 S320 P321 S326 E331 Y349 H388 H410 E412
Enzymatic activity
Enzyme Commision number 3.1.27.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0004534 5'-3' RNA exonuclease activity
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006396 RNA processing
GO:0006397 mRNA processing
GO:0006398 mRNA 3'-end processing by stem-loop binding and cleavage
GO:0031124 mRNA 3'-end processing
GO:0180010 co-transcriptional mRNA 3'-end processing, cleavage and polyadenylation pathway
GO:1900087 positive regulation of G1/S transition of mitotic cell cycle
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005847 mRNA cleavage and polyadenylation specificity factor complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6v4x, PDBe:6v4x, PDBj:6v4x
PDBsum6v4x
PubMed32029631
UniProtQ9UKF6|CPSF3_HUMAN Cleavage and polyadenylation specificity factor subunit 3 (Gene Name=CPSF3)

[Back to BioLiP]