Structure of PDB 6uud Chain H Binding Site BS01

Receptor Information
>6uud Chain H (length=220) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVHLQQSGGEVARPGASVKLSCKASGYTFTGYGLSWVKQRTGQGLEWIGE
IYPRSGNTYYNEKFKGKATLTADKSSSTAYMELRSLTSEDSAVYFCARSW
GNSSFVYWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY
FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI
CNVNHKPSNTKVDKKVEPKS
Ligand information
>6uud Chain A (length=12) Species: 5833 (Plasmodium falciparum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EDNEKLRKPKHK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uud A high-affinity antibody against the CSP N-terminal domain lacks Plasmodium falciparum inhibitory activity.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		G31 Y32 E50 Y52 R53 N56 Y58 S95 G97 N98 S100
Binding residue
(residue number reindexed from 1)		G31 Y32 E50 Y52 R54 N57 Y59 S99 G101 N102 S104
External links