Structure of PDB 6ult Chain H Binding Site BS01

Receptor Information
>6ult Chain H (length=108) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMD
LSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDV
FEFRYAKM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ult Cyclic peptides can engage a single binding pocket through highly divergent modes.
Resolution2.8 Å
Binding residue
(original residue number in PDB)
G382 L383 Y428 N429 P430 H433
Binding residue
(residue number reindexed from 1)
G37 L38 Y83 N84 P85 H88
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6ult, PDBe:6ult, PDBj:6ult
PDBsum6ult
PubMed33046654
UniProtP25440|BRD2_HUMAN Bromodomain-containing protein 2 (Gene Name=BRD2)

[Back to BioLiP]